PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00053729001
Common NameGSBRNA2T00053729001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YA
Protein Properties Length: 300aa    MW: 32869.7 Da    PI: 9.7789
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00053729001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.22.4e-32175231158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          +ep++VNaKQy++Il+RR++Rakle+++kl +ksrkpylheSRh hAl+R+RgsgGrF
  GSBRNA2T00053729001 175 NEPIFVNAKQYHAILRRRKHRAKLEAQNKL-IKSRKPYLHESRHLHALKRARGSGGRF 231
                          59****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.3E-36173234IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.46174234IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.8E-27176231IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.7E-23177199IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860179199IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.7E-23208231IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MQVFQSKDSS GSTWENSNIQ RSQSFSLTKN MMMMSTTQLP SSMKHSSLQL QNQDSSSTQS  60
TGESGGGEAA SFGEPIHYGC NSIVANTNLS DFVKPLNLFV VGYNKSTTTS SIVSQEPVFP  120
PSACGLPSWP LQCAETSHFN GFLAPEYASQ PTLSHLEMMG LVTPRVPLPH NIQENEPIFV  180
NAKQYHAILR RRKHRAKLEA QNKLIKSRKP YLHESRHLHA LKRARGSGGR FLNTKKLQES  240
SNSSLCSSSQ MANGDGEGFS KSSTTPSSGS DRNNMFQNTP FRFSGYPSTH HVSALMSET*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-19176236363NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.190481e-137seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00053729001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013643655.10.0PREDICTED: nuclear transcription factor Y subunit A-5-like
RefseqXP_013643654.10.0PREDICTED: nuclear transcription factor Y subunit A-5-like
RefseqXP_013592817.10.0PREDICTED: nuclear transcription factor Y subunit A-5
RefseqXP_013592816.10.0PREDICTED: nuclear transcription factor Y subunit A-5
SwissprotQ9SYH41e-136NFYA5_ARATH; Nuclear transcription factor Y subunit A-5
TrEMBLA0A078H6F40.0A0A078H6F4_BRANA; BnaC06g06950D protein
STRINGBra037968.1-P1e-161(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116331733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.11e-112nuclear factor Y, subunit A5
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]